PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G032100.1.p
Common NameS250_18C08.9, Sb07g002780, SORBIDRAFT_07g002780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family HD-ZIP
Protein Properties Length: 815aa    MW: 86797.1 Da    PI: 6.0094
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G032100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox634.5e-20111166156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           +++ +++t++q++eLe++F++ ++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Sobic.007G032100.1.p 111 KKRYHRHTQHQIQELEAFFKEYPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 166
                           688999***********************************************999 PP

2START197.36.8e-623035281206
                           HHHHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S CS
                 START   1 elaeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla 77 
                           ela +a++elv++a+++ep+W           e +n++e+ + f+++ +      ++ea+r+++vv+m++++l e l+d++ qW++ + 
  Sobic.007G032100.1.p 303 ELAVAAMEELVRMAQLGEPLWIPALvvdgatiETLNEEEYARGFPSGVGpklpeLRSEASRETVVVIMNHVNLIEMLMDVN-QWSTLFS 390
                           57899****************998889*****************77666********************************.******9 PP

                           ....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEE CS
                 START  78 ....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgilie 155
                               +a+tlev+s+g      galqlm+ae+q++splvp R++ f+Ry++q+++g+w++vdvSv+  +     + ++R++++pSg+li+
  Sobic.007G032100.1.p 391 sivsRAATLEVLSTGvagnynGALQLMTAEFQMPSPLVPtRESQFLRYCKQHTDGSWAVVDVSVEGLRAS--GQAGARGRRRPSGCLIQ 477
                           9999***************************************************************996..579************** PP

                           EECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                 START 156 pksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                           +++ng+s+vtwvehv+ ++ ++h l+r+lv sgla+ga++w a+l+rqce+
  Sobic.007G032100.1.p 478 EMPNGYSRVTWVEHVEADDMMVHDLYRPLVCSGLAFGARRWAAALERQCER 528
                           *************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-2293151IPR009057Homeodomain-like
SuperFamilySSF466891.0E-1997169IPR009057Homeodomain-like
PROSITE profilePS5007117.216108168IPR001356Homeobox domain
SMARTSM003897.7E-19109172IPR001356Homeobox domain
CDDcd000867.83E-19110169No hitNo description
PfamPF000461.2E-17111166IPR001356Homeobox domain
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.602.6E-4152196IPR009057Homeodomain-like
PROSITE profilePS5084842.025294531IPR002913START domain
CDDcd088755.55E-118298527No hitNo description
SuperFamilySSF559613.16E-34298530No hitNo description
SMARTSM002346.2E-58303528IPR002913START domain
PfamPF018526.5E-51304528IPR002913START domain
Gene3DG3DSA:3.30.530.202.6E-6375499IPR023393START-like domain
SuperFamilySSF559615.5E-23556798No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 815 aa     Download sequence    Send to blast
MPGGLMIPGR NMPTAAAMIG GLASYAASLG QNMMDGHHQL AMMQQQQHQN HGQQQQHPPQ  60
AATSESDARG PRHDELMMES KSGSDNMEGG AGSGSGGEEL QEDLSLQPAR KKRYHRHTQH  120
QIQELEAFFK EYPHPDDKQR KELSRELGLE PLQVKFWFQN KRTQMKTQQE RHENMQLRAE  180
NEKLRAENAR YKDALANASC PNCGGPATAV IGEMSFDEHH LRIENARLRD EVDRISTIAA  240
KYVGKPAGSL LPNLSNISSA SMAPYPPPPP LSSHHLLPGG TDMFGGLHLH GAAAGFDKGL  300
VVELAVAAME ELVRMAQLGE PLWIPALVVD GATIETLNEE EYARGFPSGV GPKLPELRSE  360
ASRETVVVIM NHVNLIEMLM DVNQWSTLFS SIVSRAATLE VLSTGVAGNY NGALQLMTAE  420
FQMPSPLVPT RESQFLRYCK QHTDGSWAVV DVSVEGLRAS GQAGARGRRR PSGCLIQEMP  480
NGYSRVTWVE HVEADDMMVH DLYRPLVCSG LAFGARRWAA ALERQCERLA SAMASGVPAG  540
PSSGGDAVGV VTSVEGRRSM LRLAERMVTS FCGGVTASTT HQWTKLSGSG AEDVRVMTRK  600
SVDDPGRPPG IILNAATSFW LPVPPARVFG FLRDDATRSE WDILSNGGDV QEMAHIANGR  660
DHGNAVSLLR VNNANSNQSN MLILQECCTD ATGSYVIYAP VDVVAMNVVL NGGDPDYVAL  720
LPSGFAILPD GSGAGGAPPG FAVLPDGPGA GGGGGGGGGS LLTVAFQILV DSVPTAKLSL  780
GSVATVNSLI ACTVERIKAA VAADNIGGGG AVPQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.206130.0embryo| ovary
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4662000.0AF466200.2 Sorghum bicolor putative protein kinase gene, partial cds; putative Cf-2, fertilization-independent endosperm proteins, hypothetical protein, putative non-LTR retroelement reverse transcriptase, OCL5 protein, tryptophan synthase beta-subunit, hypothetical proteins, putative AP endonuclease, putative RNA polymerase II complex component SRB7, putative beta-1,3-glucanase, hypothetical protein, TNP2-like protein, hypothetical protein, putative phosphate/phosphoenolpyruvate translocator, putative protein, hypothetical proteins, putative galactosyltransferase family, hypothetical protein, putative cytochrome P450 family, putative lipid transfer protein, putative photoreceptor-interacting protein, and hypothetical protein genes, complete cds; and hypothetical protein gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445014.10.0hypothetical protein SORBIDRAFT_07g002780
SwissprotA3BPF20.0ROC7_ORYSJ; Homeobox-leucine zipper protein ROC7
TrEMBLQ8W0T50.0Q8W0T5_SORBI; OCL5 protein
STRINGSb07g002780.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Swigonov
    Close split of sorghum and maize genome progenitors.
    Genome Res., 2004. 14(10A): p. 1916-23
    [PMID:15466289]
  2. Lai J, et al.
    Gene loss and movement in the maize genome.
    Genome Res., 2004. 14(10A): p. 1924-31
    [PMID:15466290]